Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Cell Permeable Peptides (CPP) / Drug Delivery Peptides  >>  Anti-BetaGamma (MPS-Phosducin-like protein C terminus)

Product Name Anti - BetaGamma (MPS - Phosducin - like protein C terminus)
Size 0.5 mg
Catalog # 24177
US$ $242
Detailed Information Datasheet
Storage -20°C
References Ref: Orr, A. et al. J. Biol. Chem. 277, 20453 (2002).
Molecular Weight 4601.4
Sequence
(One-Letter Code)
AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE
Sequence
(Three-Letter Code)
H - Ala - Ala - Val - Ala - Leu - Leu - Pro - Ala - Val - Leu - Leu - Ala - Leu - Leu - Ala - Val - Thr - Asp - Gln - Leu - Gly - Glu - Asp - Phe - Phe - Ala - Val - Asp - Leu - Glu - Ala - Phe - Leu - Gln - Glu - Phe - Gly - Leu - Leu - Pro - Glu - Lys - Glu - OH
Product Citations Morrey, C. et al. (2008). Cardioprotective Effect of Histamine H3-Receptor Activation: Pivotal Role of Gβγ-Dependent Inhibition of Voltage-Operated Ca2+ Channels. J Pharmacol Exp Ther 326, 871.
Orr, A. et al. (2002). Thrombospondin Stimulates Focal Adhesion Disassembly through Gi- and Phosphoinositide 3-Kinase-dependent ERK Activation. J Biol Chem. 277, 20453.
     
  < Back