Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Corticotropin Related Peptides  >>  Biotin-Corticotropin Releasing Factor, Biotin-CRF, human, rat

Product Name Biotin - Corticotropin Releasing Factor, Biotin - CRF, human, rat
Biotin - SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII - NH2
Size 0.5 mg
Catalog # 23976
US$ $303
Purity % Peak Area By HPLC ≥ 95%
Storage -20C
Molecular Weight 4984.8
Sequence
(One-Letter Code)
Biotin-SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
Sequence
(Three-Letter Code)
Biotin - Ser - Glu - Glu - Pro - Pro - Ile - Ser - Leu - Asp - Leu - Thr - Phe - His - Leu - Leu - Arg - Glu - Val - Leu - Glu - Met - Ala - Arg - Ala - Glu - Gln - Leu - Ala - Gln - Gln - Ala - His - Ser - Asn - Arg - Lys - Leu - Met - Glu - Ile - Ile - NH2
     
  < Back