Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Defensins  >>  HNP-1, Defensin Human Neutrophil Peptide-1

Product Name HNP - 1, Defensin Human Neutrophil Peptide - 1
Size 0.1 mg
Catalog # 60743
US$ $198
Purity % Peak Area By HPLC ≥ 95%
Description

Mammalian defensins are abundant in the cytoplasmic azurophilic granules of neutrophils, Paneth cells of the small intestine and some macrophages. Human a-defensin-1 (HNP-1) is a peptide possessing both broad antimicrobial (both Gram-positive and Gram-negative bacteria) and cytotoxic activities. HNP-1 reduces adenoviral infection by more than 95%.

Detailed Information Datasheet
Storage -20°C
References Ref: Frick, I. et al. J. Biol. Chem. 278, 16561 (2003); Valore, E. at al. J. Clin. Invest. 97, 1624 (1996); Mizukawa, N. et al. Anticancer Res. 20, 1125 (2000); Bastian, A. and H. Schafer, Regul Pept. 101, 157 (2001).
Molecular Weight 3442.1
Sequence
(One-Letter Code)
ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 2-30, 4-19, 9-29)
Sequence
(Three-Letter Code)
H - Ala - Cys - Tyr - Cys - Arg - Ile - Pro - Ala - Cys - Ile - Ala - Gly - Glu - Arg - Arg - Tyr - Gly - Thr - Cys - Ile - Tyr - Gln - Gly - Arg - Leu - Trp - Ala - Phe - Cys - Cys - OH (Disulfide bridge: 2 - 30, 4 - 19, 9 - 29)
Product Citations Vega, LA. et al. (2012). Cationic antimicrobial peptides disrupt the Streptococcus pyogenes ExPortal. Mol Microbiol 85, 1119. doi: 10.1111/j.1365-2958.2012.08163.x (2012).
Laing, S. et al. (2011). Strategies for the identification of arginine ADP-ribosylation sites. J Proteomics 75, 169.
     
  < Back