|
|
|
|
|
| Product Name |
hBD - 1, β - Defensin - 1, human |
| Size |
0.1 mg |
| Catalog # |
60740 |
| US$ |
$275 |
| Molecular Weight |
3929.6 |
Sequence
(One-Letter Code) |
DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (Disulfide bridge: 5-34, 12-27, 17-35) |
Sequence
(Three-Letter Code) |
H - Asp - His - Tyr - Asn - Cys - Val - Ser - Ser - Gly - Gly - Gln - Cys - Leu - Tyr - Ser - Ala - Cys - Pro - Ile - Phe - Thr - Lys - Ile - Gln - Gly - Thr - Cys - Tyr - Arg - Gly - Lys - Ala - Lys - Cys - Cys - Lys - OH (Disulfide bridge: 5 - 34, 12 - 27, 17 - 35) |
| Storage |
-20°C |
| Detailed Information |
 Material Safety Data Sheets (MSDS)
|
| Product Citations |
Kooi, C. & Sokol, PA. (2009). Burkholderia cenocepacia zinc metalloproteases influence resistance to antimicrobial peptides. Microbiol. doi:10.1099/mic.0.028969-0.
Gryllos, I. et al. (2008). Induction of group A Streptococcus virulence by a human antimicrobial peptide. PNAS 105, 16755.
|
|
|
|
|
|
|
