Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
	Stay Logged In

Forgot your Customer ID or Password?

New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Big Endothelin 1 (1-39), porcine

Product Name	Big Endothelin 1 (1 - 39), porcine
Size	1 mg
Catalog #	20715
US$	$583
Purity	% Peak Area By HPLC ≥ 95%
Detailed Information	Material Safety Data Sheets (MSDS)
Storage	-20°C
Molecular Weight	4384.1
Sequence (One-Letter Code)	CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS (Disulfide bridge: 1-15 and 3-11)
Sequence (Three-Letter Code)	H - Cys - Ser - Cys - Ser - Ser - Leu - Met - Asp - Lys - Glu - Cys - Val - Tyr - Phe - Cys - His - Leu - Asp - Ile - Ile - Trp - Val - Asn - Thr - Pro - Glu - His - Ile - Val - Pro - Tyr - Gly - Leu - Gly - Ser - Pro - Ser - Arg - Ser - OH