Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Exendins  >>  Exendin 3

Product Name Exendin 3
HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS - NH2
Size 1 mg
Catalog # AS-24462
US$ $435
Purity % Peak Area By HPLC ≥ 95%
Description

Exendin-3, derived from Heloderma horridum venom, differs from Exendin-4 by only two amino acid substitutions, Ser2-Asp3 instead of Gly2-Glu3. Exendin-3 and Exendin-4 both can stimulate the synthesis or expression of the hormone insulin.

Storage -20C
References Eng, J. et al. J Biol Chem 265, 20259 (1990)
Molecular Weight 4202.6
Sequence
(One-Letter Code)
HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Sequence
(Three-Letter Code)
H - His - Ser - Asp - Gly - Thr - Phe - Thr - Ser - Asp - Leu - Ser - Lys - Gln - Met - Glu - Glu - Glu - Ala - Val - Arg - Leu - Phe - Ile - Glu - Trp - Leu - Lys - Asn - Gly - Gly - Pro - Ser - Ser - Gly - Ala - Pro - Pro - Pro - Ser - NH2
     
  < Back