Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
	Stay Logged In

Forgot your Customer ID or Password?

New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Exendin (9-39)

Product Name	Exendin (9 - 39)
Size	0.5 mg
Catalog #	24467
US$	$231
Purity	% Peak Area By HPLC ≥ 95%
Description	This peptide is a potent Glucagon-Like Peptide 1 (GLP-1) receptor antagonist. It is a competitive inhibitor of Exendin-3 and Exendin-4.
Detailed Information	Datasheet
Storage	-20°C
References	Ref: Fehmann, HC. et al. Peptides 15, 453 (1994).
Molecular Weight	3369.8
Sequence (One-Letter Code)	DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Sequence (Three-Letter Code)	H - Asp - Leu - Ser - Lys - Gln - Met - Glu - Glu - Glu - Ala - Val - Arg - Leu - Phe - Ile - Glu - Trp - Leu - Lys - Asn - Gly - Gly - Pro - Ser - Ser - Gly - Ala - Pro - Pro - Pro - Ser - NH2