About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Other Genomic Products
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Exendins  >>  Exendin 4

Product Name Exendin 4
Size 0.5 mg
Catalog # 24463
US$ $75
Molecular Weight 4186.6
Sequence
(One-Letter Code)
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Sequence
(Three-Letter Code)
H - His - Gly - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Leu - Ser - Lys - Gln - Met - Glu - Glu - Glu - Ala - Val - Arg - Leu - Phe - Ile - Glu - Trp - Leu - Lys - Asn - Gly - Gly - Pro - Ser - Ser - Gly - Ala - Pro - Pro - Pro - Ser - NH2
Description

This peptide, like Exendin-3, stimulates an increase in acinar cAMP, without stimulating the release of amylase.

References Ref: Eng, J. et al. J. Biol. Chem. 267, 7402 (1992).
Storage -20°C
Detailed Information Product Information
Material Safety Data Sheets (MSDS)
Product Citations Ding, J. et al. (2009). Pax6 haploinsufficiency causes abnormal metabolic homeostasis by down-regulating GLP-1 in mice. Endocrin. 10.1210/en.2008-1006.
Sharma, A. et al. Diabetologia 49, 1247 (2006).
     
  < Back