Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Account Login My Cart My Custom Reports My Favorites Logout
About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Exendins  >>  Exendin 4
Product Name Exendin 4
Size 1 mg
Catalog # 24464
US$ $137
Purity % Peak Area By HPLC ≥ 95%
Description

This peptide, like Exendin-3, stimulates an increase in acinar cAMP, without stimulating the release of amylase.
Detailed Information Datasheet
Storage -20°C
References Ref: Eng, J. et al. J. Biol. Chem. 267, 7402 (1992).
Molecular Weight 4186.6
Sequence
(One-Letter Code)		 HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Sequence
(Three-Letter Code)		 H - His - Gly - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Leu - Ser - Lys - Gln - Met - Glu - Glu - Glu - Ala - Val - Arg - Leu - Phe - Ile - Glu - Trp - Leu - Lys - Asn - Gly - Gly - Pro - Ser - Ser - Gly - Ala - Pro - Pro - Pro - Ser - NH2
Product Citations Potthoff, MJ. et al. (2013). Colesevelam suppresses hepatic glycogenolysis by TGR5-mediated induction of GLP-1 action in DIO mice. Am J Physiol Gastrointest Liver Physiol 304, G371. doi: 10.​1152/​ajpgi.​00400.​2012.
Ding, J. et al. (2009). Pax6 haploinsufficiency causes abnormal metabolic homeostasis by down-regulating GLP-1 in mice. Endocrin. doi:10.1210/en.2008-1006.
Sordi, V. et al. (2009). Mesenchymal Cells Appearing in Pancreatic Tissue Culture Are Bone Marrow-Derived Stem Cells With the Capacity to Improve Transplanted Islet Function. Stemm Cells 28, 140.
Sharma, A. et al. (2006). Exendin-4 treatment improves metabolic control after rat islet transplantation to athymic mice with streptozotocin-induced diabetes. Diabetologia 49, 1247.
     
  < Back
Copyright © 2002-2011 AnaSpec, Inc. All rights reserved. | 65.39.186.246 (USA) | Site Map | Terms & Conditions