Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Exendins  >>  Biotin-Exendin 4

Product Name Biotin - Exendin 4
Biotin - HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS - NH2
Size 0.5 mg
Catalog # AS-60279-05
US$ $385
Purity % Peak Area By HPLC ≥ 95%
Description

This peptide, Exendin-4, has a biotin on the N-terminus. Exendin-4, an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.

Detailed Information Datasheet
Storage -20°C
References Eng, J. et al. J Biol Chem 267, 7402 (1992)
Greig, NH. et al. Diabetolog 42, 45 (1999)
Göke R. et al. J Biol Chem 268, 19650 (1993)
Molecular Weight 4412.9
Sequence
(One-Letter Code)
Biotin-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Sequence
(Three-Letter Code)
Biotin - His - Gly - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Leu - Ser - Lys - Gln - Met - Glu - Glu - Glu - Ala - Val - Arg - Leu - Phe - Ile - Glu - Trp - Leu - Lys - Asn - Gly - Gly - Pro - Ser - Ser - Gly - Ala - Pro - Pro - Pro - Ser - NH2
     
  < Back