Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Exendins  >>  Exendin 4 (3-39)

Product Name Exendin 4 (3 - 39)
EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS - NH2
Size 0.5 mg
Catalog # AS-24465
US$ $242
Purity % Peak Area By HPLC ≥ 95%
Description

A potent Glucagon-Like Peptide 1 (GLP-1) receptor antagonist.

Detailed Information Datasheet
Storage -20C
Molecular Weight 3992.4
Sequence
(One-Letter Code)
EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Sequence
(Three-Letter Code)
H - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Leu - Ser - Lys - Gln - Met - Glu - Glu - Glu - Ala - Val - Arg - Leu - Phe - Ile - Glu - Trp - Leu - Lys - Asn - Gly - Gly - Pro - Ser - Ser - Gly - Ala - Pro - Pro - Pro - Ser - NH2
Product Citations Potthoff, MJ. et al. (2013). Colesevelam suppresses hepatic glycogenolysis by TGR5-mediated induction of GLP-1 action in DIO mice. Am J Physiol Gastrointest Liver Physiol 304, G371. doi: 10.​1152/​ajpgi.​00400.​2012.
     
  < Back