Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  ACTH and Related Peptides  >>  ACTH (7-38), human

Product Name ACTH (7 - 38), human
FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE
Size 1 mg
Catalog # 20618
US$ $121
Purity % Peak Area By HPLC ≥ 95%
Description

Corticotropin-inhibiting peptide (CIP), the 7-38 fragment of human ACTH (1-39), is known to act as an antagonist of ACTH receptors. It does not have any corticosteroidogenic activity.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
References Ref: Malendowicz, L. et al. J. Steroid Biochem. Mol. Biol. 67, 149 (1998); Li, CH. et al. Proc. Natl. Acad. Sci. USA 75, 4306 (1978)
Molecular Weight 3659.2
Sequence
(One-Letter Code)
FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE
Sequence
(Three-Letter Code)
H - Phe - Arg - Trp - Gly - Lys - Pro - Val - Gly - Lys - Lys - Arg - Arg - Pro - Val - Lys - Val - Tyr - Pro - Asn - Gly - Ala - Glu - Asp - Glu - Ser - Ala - Glu - Ala - Phe - Pro - Leu - Glu - OH
     
  < Back