Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Account Login My Cart My Custom Reports My Favorites Logout
About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  ACTH and Related Peptides  >>  ACTH (7-38), human
Product Name ACTH (7 - 38), human
Size 1 mg
Catalog # 20618
US$ $121
Purity % Peak Area By HPLC ≥ 95%
Description

Corticotropin-inhibiting peptide (CIP), the 7-38 fragment of human ACTH (1-39), is known to act as an antagonist of ACTH receptors. It does not have any corticosteroidogenic activity.
Detailed Information Material Safety Data Sheets (MSDS)
Storage -20°C
References Ref: Malendowicz, L. et al. J. Steroid Biochem. Mol. Biol. 67, 149 (1998); Li, CH. et al. Proc. Natl. Acad. Sci. USA 75, 4306 (1978)
Molecular Weight 3659.2
Sequence
(One-Letter Code)		 FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE
Sequence
(Three-Letter Code)		 H - Phe - Arg - Trp - Gly - Lys - Pro - Val - Gly - Lys - Lys - Arg - Arg - Pro - Val - Lys - Val - Tyr - Pro - Asn - Gly - Ala - Glu - Asp - Glu - Ser - Ala - Glu - Ala - Phe - Pro - Leu - Glu - OH
     
  < Back
Copyright © 2002-2011 AnaSpec, Inc. All rights reserved. | 65.39.186.246 (USA) | Site Map | Terms & Conditions