Galanin, a 29 or 30 (in human) amino acid neuropeptide, is found in the central and peripheral nervous systems and displays several important physiological activities. These actions are mediated through distinct G protein-coupled receptors.
Ref: Wang, S. et al. J. Biol. Chem. 272, 31949 (1997).
Molecular Weight
3157.5
Sequence (One-Letter Code)
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
Sequence (Three-Letter Code)
H - Gly - Trp - Thr - Leu - Asn - Ser - Ala - Gly - Tyr - Leu - Leu - Gly - Pro - His - Ala - Val - Gly - Asn - His - Arg - Ser - Phe - Ser - Asp - Lys - Asn - Gly - Leu - Thr - Ser - OH
Datasheet
Material Safety Data Sheets (MSDS)
