Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Galanins  >>  Galanin-Lys(Biotin), human, FAM-labeled

Product Name Galanin - Lys(Biotin), human, FAM - labeled
FAM - GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK(Biotin)
Size 0.5 mg
Catalog # AS-23620
US$ $253
Purity % Peak Area By HPLC ≥ 95%
Description

This is a N-terminus fluorescent (FAM)-labeled and C-terminus biotinylated Galanin peptide, Abs/Em=494/521nm.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
Molecular Weight 3870.2
Sequence
(One-Letter Code)
FAM-GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK(Biotin)
Sequence
(Three-Letter Code)
FAM - Gly - Trp - Thr - Leu - Asn - Ser - Ala - Gly - Tyr - Leu - Leu - Gly - Pro - His - Ala - Val - Gly - Asn - His - Arg - Ser - Phe - Ser - Asp - Lys - Asn - Gly - Leu - Thr - Ser - Lys(Biotin) - OH
     
  < Back