Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
	Stay Logged In

Forgot your Customer ID or Password?

New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Galanin-Lys(Biotin), human

Product Name	Galanin - Lys(Biotin), human
Size	0.5 mg
Catalog #	23638
US$	$253
Purity	% Peak Area By HPLC ≥ 95%
Description	Biotin is attached to the epsilon group of the extra lysine added to the C-terminus of this Galanin.
Detailed Information	Material Safety Data Sheets (MSDS)
Storage	-20°C
Molecular Weight	3511.9
Sequence (One-Letter Code)	GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK(Biotin)
Sequence (Three-Letter Code)	H - Gly - Trp - Thr - Leu - Asn - Ser - Ala - Gly - Tyr - Leu - Leu - Gly - Pro - His - Ala - Val - Gly - Asn - His - Arg - Ser - Phe - Ser - Asp - Lys - Asn - Gly - Leu - Thr - Ser - Lys(Biotin) - OH