This peptide, formed by cleavage of two basic residues, is an endogenous peptide secreted into the circulation by intestinal L cells. A potent glucose-dependent insulinotropic hormone, it has important actions on gastric motility, on the suppression of plasma glucagon levels and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. It potentiates insulin secretion by pancreatic A-cells in a glucose-dependent manner and inhibits gastric emptying and acid secretion.
Ref: Drucker, D. et al. Proc. Natl. Acad. Sci. USA 84, 3434 (1987); Kieffer, T. and J. Habener, Endo. Rev. 20, 876 (1999).
Molecular Weight
4111.5
Sequence (One-Letter Code)
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Sequence (Three-Letter Code)
H - His - Asp - Glu - Phe - Glu - Arg - His - Ala - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Val - Ser - Ser - Tyr - Leu - Glu - Gly - Gln - Ala - Ala - Lys - Glu - Phe - Ile - Ala - Trp - Leu - Val - Lys - Gly - Arg - NH2
Datasheet
Material Safety Data Sheets (MSDS)
