Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Glucagon-Like Peptides  >>  Glucagon-Like Peptide 1, GLP-1 amide, human, FAM-labeled

Product Name Glucagon - Like Peptide 1, GLP - 1 amide, human, FAM - labeled
FAM - HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2
Size 0.5 mg
Catalog # AS-23606
US$ $291
Purity % Peak Area By HPLC ≥ 95%
Description

This is fluorescent GLP-1 labeled at the peptide C-terminus with FAM, Abs/Em=494/521 nm. In response to Glucose ingestion, proglucagon in the intestinal L cells is cleaved into GLP-1 (1-36). Prior to secretion into the circulation, GLP-1 (1-36) is further processed into amidated GLP-1 (7-36)-cat# AS-22462-and small amounts of glycine-extended GLP-1 (7-37)-cat# AS-20761. Both GLP-1 (7-36) and GLP-1 (7-37), causes glucose dependent release of insulin by pancreatic beta-cells. They also play a role in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 peptides such as GLP-1 (1-36) have been used to investigate restoration of pancreatic beta cell function. GLP-1 is also produced in the central nervous system.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
References Drucker, D. et al. Proc Natl Acad Sci USA 84, 3434 (1987)
Kieffer, T. and J. Habener, Endo Rev 20, 876 (1999)
Deacon, CF. et. al. Hormone Metabolic Res 36,761 (2004), doi: 10.1055/s-2004-826160
Williams, JA. Pancreadepedia (2014), doi: 10.3998/panc.2014.7.
Molecular Weight 4469.8
Sequence
(One-Letter Code)
FAM-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Sequence
(Three-Letter Code)
FAM - His - Asp - Glu - Phe - Glu - Arg - His - Ala - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Val - Ser - Ser - Tyr - Leu - Glu - Gly - Gln - Ala - Ala - Lys - Glu - Phe - Ile - Ala - Trp - Leu - Val - Lys - Gly - Arg - NH2
     
  < Back