Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Glucagon-Like Peptides  >>  Glucagon-Like Peptide 1, GLP-1 (7-36), amide, human

Product Name Glucagon - Like Peptide 1, GLP - 1 (7 - 36), amide, human
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2
Size 0.5 mg
Catalog # 22462
US$ $127
Purity % Peak Area By HPLC ≥ 95%
Description

This peptide shares sequence with preproglucagon (78-107), amide, human.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
Molecular Weight 3297.7
Sequence
(One-Letter Code)
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Sequence
(Three-Letter Code)
H - His - Ala - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Val - Ser - Ser - Tyr - Leu - Glu - Gly - Gln - Ala - Ala - Lys - Glu - Phe - Ile - Ala - Trp - Leu - Val - Lys - Gly - Arg - NH2
     
  < Back