Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Glucagon-Like Peptides  >>  Glucagon-Like Peptide 1, GLP-1 (7-37)

Product Name Glucagon - Like Peptide 1, GLP - 1 (7 - 37)
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Size 0.5 mg
Catalog # AS-20761
US$ $154
Purity % Peak Area By HPLC ≥ 95%
Detailed Information Material Safety Data Sheets (MSDS)
Storage -20°C
References Ref: Brubaker, P. and D. Drucker, Receptors Channels 8, 179 (2002); Leonova, J. et al. Am. J. Physiol. Cell Physiol. 281, C1495 (2001); Drucker, D. et al. Proc. Natl. Acad. Sci. USA 84, 3434 (1987); Rönnbäck, L. and E. Hansson, J. Neuroinflam. 1, 22 (2004); Rothstein JD. et al. Neuron. 16, 675 (1996); Sonnewald, U. et al. Pharmacol. 3011 (2002).
Molecular Weight 3355.7
Sequence
(One-Letter Code)
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Sequence
(Three-Letter Code)
H - His - Ala - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Val - Ser - Ser - Tyr - Leu - Glu - Gly - Gln - Ala - Ala - Lys - Glu - Phe - Ile - Ala - Trp - Leu - Val - Lys - Gly - Arg - Gly - OH
     
  < Back