Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Glucagon-Like Peptides  >>  Glucagon-Like Peptide 1, GLP-1 (7-37)

Product Name Glucagon - Like Peptide 1, GLP - 1 (7 - 37)
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Size 1 mg
Catalog # AS-20762
US$ $275
Purity % Peak Area By HPLC ≥ 95%
Description

GLP-1 (7-37) is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of proglucagon. Both GLP-1 (7-36) and GLP-1 (7-37) play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. Although GLP-1 (7-37) is bioactive, it is available in lesser amounts than GLP-1 (7-36) and is not amidated.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20°C
References Brubaker, P. and D. Drucker, Receptors Channels 8, 179 (2002)
Leonova, J. et al. Am J Physiol Cell Physiol 281, C1495 (2001)
Drucker, D. et al. Proc Natl Acad Sci USA 84, 3434 (1987)
Rönnbäck, L. and E. Hansson, J Neuroinflamm 1, 22 (2004)
Rothstein, JD. et al. Neuron 16, 675 (1996)
Molecular Weight 3355.7
Sequence
(One-Letter Code)
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Sequence
(Three-Letter Code)
H - His - Ala - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Val - Ser - Ser - Tyr - Leu - Glu - Gly - Gln - Ala - Ala - Lys - Glu - Phe - Ile - Ala - Trp - Leu - Val - Lys - Gly - Arg - Gly - OH
     
  < Back