Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Account Login My Cart My Custom Reports My Favorites Logout
About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-42) and Related Peptides  >>  Beta-Amyloid (1-42)-Lys(Biotin)-NH2
Product Name Beta - Amyloid (1 - 42) - Lys(Biotin) - NH2
Size 0.5 mg
Catalog # 61484-05
US$ $605
Purity % Peak Area By HPLC ≥ 95%
Description

The difference between this recently released and the previous product (Cat# 23527) is the change at the C terminus from a carboxylic acid to an amide. The biological activity should remain the same.
Detailed Information Datasheet
Storage -20°C
References Elbaum, D. et al. Biochem. Biophys. Res. Commun. 267, 733 (2000).
Molecular Weight 4867.6
Sequence
(One-Letter Code)		 DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-K(Biotin)-NH2
Sequence
(Three-Letter Code)		 H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - Lys(Biotin) - NH2
     
  < Back
Copyright © 2002-2011 AnaSpec, Inc. All rights reserved. | 65.39.186.246 (USA) | Site Map | Terms & Conditions