Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Antimicrobial and Related Peptides  >>  Elafin

Product Name Elafin
Size 0.1 mg
Catalog # 61641
US$ $237
Purity % Peak Area By HPLC ≥ 95%
Description

This is a fragment of the elafin (elastase-specific inhibitor), an antiproteinase and antimicrobial (gram-positive and gram-negative respiratory pathogens) molecule that is expressed at epithelial sites. Elafin is a potent inhibitor of HNE and proteinase 3 produced in the skin, and in the airways , which is up-regulated in response to early inflammatory cytokines such as TNF and IL-1. Elafin, along with SLPI, also shares characteristics with antimicrobial defensin-like molecules in being a low molecular weight cationic peptide with the ability to eliminate pulmonary pathogens.

Detailed Information Datasheet
Storage -20°C
References King, A. et al. J. Clin. Endo. Metab. 88, 4426 (2003); Wiedow, O. et al . J. Biol. Chem. 265, 14791 (1990); Wiedow, O. et al. Biochem. Biophys. Res. Commun. 174, 6 (1991); Tremblay, G. et al. Am. J. Respir. Crit. Care Med. 154, 1092 (1996); Simpson, AJ. et al. J. Immunol. 167, 1778 (2001).
Molecular Weight 5999.3
Sequence
(One-Letter Code)
AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16- Cys45, Cys23- Cys49, Cys32- Cys44, Cys38-Cys53)
Sequence
(Three-Letter Code)
H - Ala - Gln - Glu - Pro - Val - Lys - Gly - Pro - Val - Ser - Thr - Lys - Pro - Gly - Ser - Cys - Pro - Ile - Ile - Leu - Ile - Arg - Cys - Ala - Met - Leu - Asn - Pro - Pro - Asn - Arg - Cys - Leu - Lys - Asp - Thr - Asp - Cys - Pro - Gly - Ile - Lys - Lys - Cys - Cys - Glu - Gly - Ser - Cys - Gly - Met - Ala - Cys - Phe - Val - Pro - Gln - OH (Disufide bonds between Cys16 - Cys45, Cys23 - Cys49, Cys32 - Cys44, Cys38 - Cys53)
     
  < Back