Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid Peptides - Mouse/Rat  >>  Biotin-LC-beta-Amyloid (1-40), mouse, rat

Product Name Biotin - LC - beta - Amyloid (1 - 40), mouse, rat
Biotin - LC - DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
Size 0.1 mg
Catalog # AS-61717-01
US$ $110
Purity % Peak Area By HPLC ≥ 95%
Storage -20C
Molecular Weight 4573.3
Sequence
(One-Letter Code)
Biotin-LC-DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence
(Three-Letter Code)
Biotin - LC - Asp - Ala - Glu - Phe - Gly - His - Asp - Ser - Gly - Phe - Glu - Val - Arg - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH
     
  < Back