Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-43) to (1-49) and (1-55) Peptides  >>  Beta-Amyloid (1-49), Human

Product Name Beta - Amyloid (1 - 49), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITL
Size 0.1 mg
Catalog # 61963-01
US$ $159
Purity % Peak Area By HPLC ≥ 95%
Description

This is the -Amyloid peptide amino acid residues 1 to 49. This sequence may be used in the -Amyloid structure and aggregation studies.

Storage -20C
Molecular Weight 5254.1
Sequence
(One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITL
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - Thr - Val - Ile - Val - Ile - Thr - Leu - OH
     
  < Back