Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyte® Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Antimicrobial and Related Peptides  >>  LL-37, Antimicrobial Peptide, human

Product Name LL - 37, Antimicrobial Peptide, human
Size 1 mg
Catalog # 61302
US$ $170
Purity % Peak Area By HPLC ≥ 95%
Description

Antimicrobial peptide LL-37,  belonging  to the cathelicidin family,  is the first amphipathic alpha-helical peptide isolated from human.  It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds.  Cytotoxic to both bacterial and normal eukaryotic cells , LL-37 is significantly resistant to proteolytic degradation in solution. 

Detailed Information Datasheet
Storage -20°C
References Dürr, UHN. et al. Biochim. Biophys. Acta 1758, 1408 (2006); Neville, F. et al. Biophys. J. 90, 1275 (2006); Oren, Z. et al. Biochem. J. 341, 501(1999).
Molecular Weight 4493.3
Sequence
(One-Letter Code)
[LL-37, 37 aa]
Sequence
(Three-Letter Code)
H - Leu - Leu - Gly - Asp - Phe - Phe - Arg - Lys - Ser - Lys - Glu - Lys - Ile - Gly - Lys - Glu - Phe - Lys - Arg - Ile - Val - Gln - Arg - Ile - Lys - Asp - Phe - Leu - Arg - Asn - Leu - Val - Pro - Arg - Thr - Glu - Ser - OH
Product Citations Gilmore, SA. et al. ACS Chem Biol 7, 863. doi: 10.1021/cb200311s (2012).
Hocquellet, A. et al. Peptides 36, 303 (2012).
Love, JF. et al. mBio 3 doi: 10.1128/​mBio.00394-12 (2012).
McQuade, R. et al. Anaerobe 286, 18890. doi: 10.1074/jbc.M110.206110 (2012).
Richards, SM. et al. Front Cell Infect Microbiol 2, 102. doi: 10.3389/fcimb.2012.00102 (2012).
Strandberg, KL. et al. Infect Immun doi: 10.1128/​IAI.00672-12 (2012).
Sun, Y. et al. J Bacteriol 194, 5274. doi: 10.1128/​JB.00045-12 (2012).
Vega, LA. et al. Mol Microbiol 85, 1119. doi: 10.1111/j.1365-2958.2012.08163.x (2012).
Wu, W. et al. Leukemia 26, 736. doi: 10.1038/leu.2011.252 (2012).
Campbell, GR. and SA. Spector JBC 286, 18890. doi: 10.1074/jbc.M110.206110 (2011).
Dean, SN. et al. Front Microbiol 2, 128. doi: 10.3389/fmicb.2011.00128 (2011).
Lebeer, S. et al. Microbial Biotech 4, 368 (2011).
McBride, SM. et al. Microbiol 157, 1457. doi: 10.1099/mic.0.045997-0 (2011).
Sakoulas, G. et al. Antimicrob Agents Chemother 56, 838. doi: 10.1128/​AAC.05551-11 (2011).
Sochacki, KA. et al. PNAS 108, E77. doi: 10.1073/pnas.1101130108 (2011).
Subramanian, H. et al. JBC 286, 44739. doi: 10.1074/jbc.M111.277152 (2011).
Amer, L. et al. BBRC 396, 246 (2010).
Cole, JN. et al. mBio 1 doi: 10.1128/​mBio.00191-10 (2010).
Gable, JE. et al. Biochem 48, 11264. doi: 10.1021/bi900996q (2009).
Inomata, KA. et al. Eur J Oral Sci 118, 574. doi: 10.1111/j.1600-0722.2010.00775.x (2010).
Into, T. Cell Immunol 264, 104 (2010).
Kanda, N. et al. Hum Immunol 71, 1161 (2010).
Krasnodembskaya, A. et al. Stem Cells doi: 10.1002/stem.544 (2010).
Hocquellet, A. et al. Peptides 155, 2818 (2009).
Kooi, C & PA Sokol, Microbiology 155, 2818 (2009).
Yin, J & FS Yu, ARVO 10.1167/iovs.09-3904 (2009).
Purdy, GE. et al. Mol Microbiol 73, 844. doi: 10.1111/j.1365-2958.2009.06801.x (2009).
Schlamadinger, DE. et al. SPIE Proceedings 7397 doi: 10.1117/12.827439 (2009).
Lee, HM. et al. Leukemia 23, 2052. doi:10.1038/leu.2009.158 (2009).
Bourbon, C. et al. Anal Biochem 381, 279 (2008).
     
  < Back