Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Account Login My Cart My Custom Reports My Favorites Logout
About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Antimicrobial and Related Peptides  >>  mCRAMP, mouse
Product Name mCRAMP, mouse
Size 1 mg
Catalog # 61305
US$ $275
Purity % Peak Area By HPLC ≥ 95%
Description

This cathelicidin-related antimicrobial peptide (mCRAMP) is the sole murine cathelicidin. mCRAMP expression in the intestinal tract is restricted to surface epithelial cells in the colon. mCRAMP shows antimicrobial activity against the murine enteric pathogen Citrobacter rodentium and destroys skin Candida albicans.
Detailed Information Datasheet
Storage -20°C
References Limura, M. et al. J. Immunol. 174, 4901 (2005); Lopez-Garcia, B. et al. J. Invest. Dermatol. 125, 108 (2005).
Molecular Weight 3878.7
Sequence
(One-Letter Code)		 GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
Sequence
(Three-Letter Code)		 H - Gly - Leu - Leu - Arg - Lys - Gly - Gly - Glu - Lys - Ile - Gly - Glu - Lys - Leu - Lys - Lys - Ile - Gly - Gln - Lys - Ile - Lys - Asn - Phe - Phe - Gln - Lys - Leu - Val - Pro - Gln - Pro - Glu - Gln - OH
Product Citations Gregorio, J. et al. (2010). Plasmacytoid dendritic cells sense skin injury and promote wound healing through type I interferons. J Exp Med 207, 2921.
Kulkarni, MM. et al. (2011). Mammalian antimicrobial peptide influences control of cutaneous Leishmania infection.Cell Microbiol 13, 913. doi: 10.1111/j.1462-5822.2011.01589.x.
Gable, JE. et al. (2009). Fluorescence and UV resonance Raman study of peptide−vVesicle interactions of human cCathelicidin LL-37 and its F6W and F17W mutants Biochem 48, 11264. doi: 10.1021/bi900996q.
Schlamadinger, DE. et al. (2009). Toxins and antimicrobial peptides: interactions with membranes.SPIE Proceedings 7397 doi: 10.1117/12.827439.
Gryllos, I. et al. (2008). Induction of group A Streptococcus virulence by a human antimicrobial peptide. PNAS 105, 16755.
     
  < Back
Copyright © 2002-2011 AnaSpec, Inc. All rights reserved. | 65.39.186.246 (USA) | Site Map | Terms & Conditions