Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Antimicrobial and Related Peptides  >>  CAP-18, rabbit

Product Name CAP - 18, rabbit
GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
Size 0.5 mg
Catalog # 61307
US$ $231
Purity % Peak Area By HPLC ≥ 95%
Description

This 37 residue peptide is a very effective antimicrobial agent in rabbits. The CAP-18 cathelicidin-derived peptide kills bacteria by disrupting the bacterial membrane. It has a potential for the treatment of bacterial infections in normal and immunocompromised persons and individuals with cystic fibrosis. In experiments it demonstrates the greatest activity against over 20 clinical strains of Pseudomonas aeruginosa. Homologs of CAP18 in other species include humans (FALL39/LL37), mice (mCRAMP), rats (rCRAMP), and sheep (SMAP29 and SMAP34).

Storage -20C
References Travis, S et al. Infect. Immun. 68, 2748 (2000).
Molecular Weight 4433.5
Sequence
(One-Letter Code)
GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
Sequence
(Three-Letter Code)
H - Gly - Leu - Arg - Lys - Arg - Leu - Arg - Lys - Phe - Arg - Asn - Lys - Ile - Lys - Glu - Lys - Leu - Lys - Lys - Ile - Gly - Gln - Lys - Ile - Gln - Gly - Leu - Leu - Pro - Lys - Leu - Ala - Pro - Arg - Thr - Asp - Tyr - OH
     
  < Back