Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  HIV Related Peptides  >>  C34-LC-Biotin, gp41 HIV fragment

Product Name C34 - LC - Biotin, gp41 HIV fragment
WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLK(LC - Biotin)
Size 0.5 mg
Catalog # 62103
US$ $215
Purity % Peak Area By HPLC ≥ 95%
Description

This peptide C34, also known as HR2, belongs to the helical region of gp41 of HIV, C-terminal heptad repeat 2 (HR2) defined as C helix or C-peptide. This peptide is biotinylated through 6-aminohexanoate (LC) as a spacer. HIV-1 enters cells by membrane fusion, gp41. C-peptides are potent inhibitors of HIV-1 fusion.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
Molecular Weight 4715.3
Sequence
(One-Letter Code)
WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLK(LC-Biotin)
Sequence
(Three-Letter Code)
H - Trp - Met - Glu - Trp - Asp - Arg - Glu - Ile - Asn - Asn - Tyr - Thr - Ser - Leu - Ile - His - Ser - Leu - Ile - Glu - Glu - Ser - Gln - Asn - Gln - Gln - Glu - Lys - Asn - Glu - Gln - Glu - Leu - Leu - Lys(LC - BIOTIN) - NH2
     
  < Back