| Product Name |
Beta - Amyloid A4 Protein Precursor (740 - 770), APP (C31) |
| Size |
1 mg |
| Catalog # |
62073 |
| US$ |
$230 |
| Molecular Weight |
3717.1 |
Sequence
(One-Letter Code) |
AAVTPEERHLSKMQQNGYENPTYKFFEQMQN |
Sequence
(Three-Letter Code) |
H - Ala - Ala - Val - Thr - Pro - Glu - Glu - Arg - His - Leu - Ser - Lys - Met - Gln - Gln - Asn - Gly - Tyr - Glu - Asn - Pro - Thr - Tyr - Lys - Phe - Phe - Glu - Gln - Met - Gln - Asn - OH |
| Description |
This 31-amino acid peptide C31 corresponds to the C-terminal fragment of the Amyloid Precursor Protein (APP). Caspase cleavage of amyloid beta-protein precursor with the generation of C31 may be involved in the neuronal death associated with Alzheimer disease. The resultant C31 peptide is a potent inducer of apoptosis. This peptide is located in lipid rafts together with the APP-BP1, a binding protein for the intracellular domain of APP. |
| References |
Chen, Y. et al. J. Cell Biol. 163, 27 (2003); Lu, D. et al. Nat. Med. 6, 397 (2000). |
| Storage |
-20°C |
| Detailed Information |
 Material Safety Data Sheets (MSDS)
|
