Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Amyloid Peptides  >  Amyloid Precursor Protein (APP) / Amyloid Precursor-like Protein (APLP)  >>  Beta-Amyloid A4 Protein Precursor (740-770), APP (C31)

Product Name Beta - Amyloid A4 Protein Precursor (740 - 770), APP (C31)
Size 1 mg
Catalog # 62073
US$ $253
Purity % Peak Area By HPLC ≥ 95%
Description

This 31-amino acid peptide C31 corresponds to the C-terminal fragment of the Amyloid Precursor Protein (APP). Caspase cleavage of amyloid beta-protein precursor with the generation of C31 may be involved in the neuronal death associated with Alzheimer disease. The resultant C31 peptide is a potent inducer of apoptosis. This peptide is located in lipid rafts together with the APP-BP1, a binding protein for the intracellular domain of APP.

Storage -20°C
References Chen, Y. et al. J. Cell Biol. 163, 27 (2003); Lu, D. et al. Nat. Med. 6, 397 (2000).
Molecular Weight 3717.1
Sequence
(One-Letter Code)
AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
Sequence
(Three-Letter Code)
H - Ala - Ala - Val - Thr - Pro - Glu - Glu - Arg - His - Leu - Ser - Lys - Met - Gln - Gln - Asn - Gly - Tyr - Glu - Asn - Pro - Thr - Tyr - Lys - Phe - Phe - Glu - Gln - Met - Gln - Asn - OH
     
  < Back