This 31-amino acid peptide C31 corresponds to the C-terminal fragment of the Amyloid Precursor Protein (APP). Caspase cleavage of amyloid beta-protein precursor with the generation of C31 may be involved in the neuronal death associated with Alzheimer disease. The resultant C31 peptide is a potent inducer of apoptosis. This peptide is located in lipid rafts together with the APP-BP1, a binding protein for the intracellular domain of APP.
Storage
-20°C
References
Chen, Y. et al. J. Cell Biol. 163, 27 (2003); Lu, D. et al. Nat. Med. 6, 397 (2000).
Molecular Weight
3717.1
Sequence (One-Letter Code)
AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
Sequence (Three-Letter Code)
H - Ala - Ala - Val - Thr - Pro - Glu - Glu - Arg - His - Leu - Ser - Lys - Met - Gln - Gln - Asn - Gly - Tyr - Glu - Asn - Pro - Thr - Tyr - Lys - Phe - Phe - Glu - Gln - Met - Gln - Asn - OH
