Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-40) and Related Peptides  >>  [Lys22]-beta-Amyloid (1-40), Italian Mutation, Human

Product Name [Lys22] - beta - Amyloid (1 - 40), Italian Mutation, Human
DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Size 0.5 mg
Catalog # 62147
US$ $220
Purity % Peak Area By HPLC ≥ 95%
Description

This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
References Masuda, Y. et al. Bioorg. Med. Chem. 13, 6803 (2005).
Molecular Weight 4328.9
Sequence
(One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Lys - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH
     
  < Back