[Lys22] - beta - Amyloid (1 - 40), Italian Mutation
Size
0.5 mg
Catalog #
62147
US$
$220
Purity
% Peak Area By HPLC ≥ 95%
Description
This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.
Masuda, Y. et al. Bioorg. Med. Chem. 13, 6803 (2005).
Molecular Weight
4328.9
Sequence (One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Sequence (Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Lys - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH
Material Safety Data Sheets (MSDS)
