Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-40) and Related Peptides  >>  [Asn23]-beta-Amyloid (1-40), Iowa Mutation, Human

Product Name [Asn23] - beta - Amyloid (1 - 40), Iowa Mutation, Human
DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVV
Size 0.5 mg
Catalog # 62145
US$ $220
Purity % Peak Area By HPLC ≥ 95%
Description

This peptide is naturally occurring mutant within the beta-amyloid region of b-amyloid protein precursor (APP). This mutation is associated with severe cerebral amyloid beta-protein angiopathy (CAA) in Iowa kindred. The affected individuals share a missense mutation in APP at position 694. This site corresponds to residue 23 of beta-amyloid peptide resulting in substitution of asparagine for aspartic acid.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
References Van Nostrand, W. et al. J. Biol. Chem. 276, 32860 (2001); Grabowski, T. et al. Ann. Neurol. 49, 697 (2001).
Molecular Weight 4328.9
Sequence
(One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVV
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asn - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH
     
  < Back