This peptide is naturally occurring mutant within the beta-amyloid region of b-amyloid protein precursor (APP). This mutation is associated with severe cerebral amyloid beta-protein angiopathy (CAA) in Iowa kindred. The affected individuals share a missense mutation in APP at position 694. This site corresponds to residue 23 of beta-amyloid peptide resulting in substitution of asparagine for aspartic acid.
Van Nostrand, W. et al. J. Biol. Chem. 276, 32860 (2001); Grabowski, T. et al. Ann. Neurol. 49, 697 (2001).
Molecular Weight
4328.9
Sequence (One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVV
Sequence (Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asn - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH
Material Safety Data Sheets (MSDS)
