Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
	Stay Logged In

Forgot your Customer ID or Password?

New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

[Ala²⁸]-beta-Amyloid (1-40)

Product Name	[Ala²⁸] - beta - Amyloid (1 - 40)
Size	0.5 mg
Catalog #	61968-05
US$	$423
Purity	% Peak Area By HPLC ≥ 95%
Description	This is amino acids 1 to 40 fragment of the ß-Amyloid peptide, with lysines at positions 16 and 28 replaced with alanines.
Storage	-20°C
Molecular Weight	4215.7
Sequence (One-Letter Code)	DAEFRHDSGYEVHHQALVFFAEDVGSNAGAIIGLMVGGVV
Sequence (Three-Letter Code)	H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Ala - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Ala - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH

Peptides > Amyloid Peptides > Beta-Amyloid (1-40) and Related Peptides >> [Ala28]-beta-Amyloid (1-40)