Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Stay Logged In

Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-40) and Related Peptides  >>  Beta-Amyloid (1-40), DEAC-labeled, Human

Product Name Beta - Amyloid (1 - 40), DEAC - labeled, Human
(7 - Diethylaminocoumarin - 3 - yl)carbonyl - DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Size 0.1 mg
Catalog # AS-61949-01
US$ $143
Purity % Peak Area By HPLC ≥ 95%

This is amino acids 1 to 40 sequence of beta-Amyloid, labeled with DEAC. beta-Amyloid (1-40) together with beta-Amyloid (1-42) are two major C-terminal variants of the beta-Amyloid protein. These beta-Amyloid peptides undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. This peptide is labeled with DEAC, an excellent blue fluorescent dye (Ex/Em=432/472 nm).

Storage -20°C
Molecular Weight 4573.1
(One-Letter Code)
(Three-Letter Code)
(7 - Diethylaminocoumarin - 3 - yl)carbonyl - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH
  < Back