Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-40) and Related Peptides  >>  Beta-Amyloid (11-40)-Lys(Biotin)-NH2, Human

Product Name Beta - Amyloid (11 - 40) - Lys(Biotin) - NH2, Human
EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV - K(Biotin) - NH2
Size 0.5 mg
Catalog # 62471
US$ $423
Purity % Peak Area By HPLC ≥ 95%
Description

This amidated beta-Amyloid (11-40) is biotinylated at the C-terminus on the lysine side chain.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
Molecular Weight 3505.2
Sequence
(One-Letter Code)
EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2
Sequence
(Three-Letter Code)
H - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Lys(Biotin) - NH2
     
  < Back