Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-42) and Related Peptides  >>  Beta-Amyloid (3-42)-Lys(Biotin)-NH2, Human

Product Name Beta - Amyloid (3 - 42) - Lys(Biotin) - NH2, Human
EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA - K(Biotin) - NH2
Size 0.1 mg
Catalog # 61959-01
US$ $165
Purity % Peak Area By HPLC ≥ 95%
Description

This N-terminally truncated peptide corresponds to amino acids 3 to 42 fragment of beta-amyloid protein, biotinylated at the C-terminal lysine side chain.

Storage -20C
Molecular Weight 4681.4
Sequence
(One-Letter Code)
EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-K(Biotin)-NH2
Sequence
(Three-Letter Code)
H - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - Lys(Biotin) - NH2
     
  < Back