This is the ß-Amyloid peptide amino acid residues 1 to 44. This sequence may be used in the ß-Amyloid structure and aggregation studies.
Storage
-20°C
References
George, AR. and DR. Howlett, Biopolym. 50, 733 (1999), Jarrett, JT. et al. Biochem. 32, 4693 (1993).
Molecular Weight
4714.4
Sequence (One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATV
Sequence (Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - Thr - Val - OH
