Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-42) and Related Peptides  >>  [Pro31]-beta-Amyloid (1-42), Human

Product Name [Pro31] - beta - Amyloid (1 - 42), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAPIGLMVGGVVIA
Size 0.5 mg
Catalog # AS-62443
US$ $291
Purity % Peak Area By HPLC ≥ 95%
Description

This beta-amyloid peptide (1-42) has Ile31 substituted with Pro31. Substitution of Ile31 by the helix-breaking amino acid, proline, completely abrogates the oxidative stress and neurotoxic properties of beta-amyloid (1-42).

Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20C
References Butterfield, DA. Free Rad. Res. 36, 1307 (2002)
Molecular Weight 4498.1
Sequence
(One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAPIGLMVGGVVIA
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Pro - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - OH
     
  < Back