This is a fusion peptide containing amino acids 71 to 89 fragment of the Bak BH3 domain fused to antennapedia peptide. The Bcl-2 homology 3 (BH3) domain is crucial for the death-inducing and dimerization properties of pro-apoptotic members of the Bcl-2 protein family, including Bak, Bax, and Bad. Synthetic peptides corresponding to the BH3 domain of Bak bind to Bcl-xL, antagonize its anti-apoptotic function, and rapidly induce apoptosis when delivered into intact cells via fusion to the antennapedia homeoprotein internalization domain.
Storage
-20°C
References
Holinger, E. et al. J. Biol. Chem. 274, 13298 (1999).
Molecular Weight
4404.3
Sequence (One-Letter Code)
RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY
Sequence (Three-Letter Code)
H - Arg - Gln - Ile - Lys - Ile - Trp - Phe - Gln - Asn - Arg - Arg - Met - Lys - Trp - Lys - Lys - Met - Gly - Gln - Val - Gly - Arg - Gln - Leu - Ala - Ile - Ile - Gly - Asp - Asp - Ile - Asn - Arg - Arg - Tyr - OH
