Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Cancer Research Peptides  >>  Antennapedia Bak BH3 (Ant-BH3) (71-89) Fusion peptide

Product Name Antennapedia Bak BH3 (Ant - BH3) (71 - 89) Fusion peptide
RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY
Size 1 mg
Catalog # AS-62262
US$ $281
Purity % Peak Area By HPLC ≥ 95%
Description

This is a fusion peptide containing amino acids 71 to 89 fragment of the Bak BH3 domain fused to antennapedia peptide. The Bcl-2 homology 3 (BH3) domain is crucial for the death-inducing and dimerization properties of pro-apoptotic members of the Bcl-2 protein family, including Bak, Bax, and Bad. Synthetic peptides corresponding to the BH3 domain of Bak bind to Bcl-xL, antagonize its anti-apoptotic function, and rapidly induce apoptosis when delivered into intact cells via fusion to the antennapedia homeoprotein internalization domain.

Storage -20C
References Holinger, E. et al. J. Biol. Chem. 274, 13298 (1999).
Molecular Weight 4404.3
Sequence
(One-Letter Code)
RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY
Sequence
(Three-Letter Code)
H - Arg - Gln - Ile - Lys - Ile - Trp - Phe - Gln - Asn - Arg - Arg - Met - Lys - Trp - Lys - Lys - Met - Gly - Gln - Val - Gly - Arg - Gln - Leu - Ala - Ile - Ile - Gly - Asp - Asp - Ile - Asn - Arg - Arg - Tyr - OH
     
  < Back