Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  p53 Peptides  >>  p53 Tumor Suppressor (361-393), human

Product Name p53 Tumor Suppressor (361 - 393), human
GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD
Size 1 mg
Catalog # AS-62529
US$ $281
Purity % Peak Area By HPLC ≥ 95%
Description

This peptide is amino acids 361 to 393 fragment of p53 tumor suppressor protein. p53 is a transcription factor that regulates cell cycle and functions as a tumor supressor.

Storage -20C
Molecular Weight 3653.1
Sequence
(One-Letter Code)
GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD
Sequence
(Three-Letter Code)
H - Gly - Ser - Arg - Ala - His - Ser - Ser - His - Leu - Lys - Ser - Lys - Lys - Gly - Gln - Ser - Thr - Ser - Arg - His - Lys - Lys - Leu - Met - Phe - Lys - Thr - Glu - Gly - Pro - Asp - Ser - Asp - NH2
     
  < Back