This peptide is amino acids 361 to 393 fragment of p53 tumor suppressor protein. p53 is a transcription factor that regulates cell cycle and functions as a tumor supressor.
Storage
-20°C
Molecular Weight
3653.1
Sequence (One-Letter Code)
GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD
Sequence (Three-Letter Code)
H - Gly - Ser - Arg - Ala - His - Ser - Ser - His - Leu - Lys - Ser - Lys - Lys - Gly - Gln - Ser - Thr - Ser - Arg - His - Lys - Lys - Leu - Met - Phe - Lys - Thr - Glu - Gly - Pro - Asp - Ser - Asp - NH2
