Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Cell Permeable Peptides (CPP) / Drug Delivery Peptides  >>  TAT-NSF700scr

Product Name TAT - NSF700scr
Size 1 mg
Catalog # 62209
US$ $308
Description

This scrambled human immunodeficiency virus (HIV) transactivator of transcription (TAT) N-ethylmaleimide-sensitive factor (NSF) 700scr peptide is used as a control peptide to TAT-NSF700 peptide. It does not inhibit the disassembly activity of NSF in contrast to the TAT-NSF700 which plays a critical role in regulating exocytosis.

Detailed Information Datasheet
Storage -20°C
References Morrell, C. et al. JPET 314, 155 (2005).
Molecular Weight 4109.9
Sequence
(One-Letter Code)
YGRKKRRQRRRGGGIPPVYFSRLDLNLVVLLLAQL
Sequence
(Three-Letter Code)
H - Tyr - Gly - Arg - Lys - Lys - Arg - Arg - Gln - Arg - Arg - Arg - Gly - Gly - Gly - Ile - Pro - Pro - Val - Tyr - Phe - Ser - Arg - Leu - Asp - Leu - Asn - Leu - Val - Val - Leu - Leu - Leu - Ala - Gln - Leu - OH
     
  < Back