Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyte® Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Cell Permeable Peptides (CPP) / Drug Delivery Peptides  >>  Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R)

Product Name Chimeric Rabies Virus Glycoprotein Fragment (RVG - 9R)
Size 1 mg
Catalog # 62565
US$ $484
Description

This chimeric peptide is a fragment derived from rabies virus glycoprotein (RVG). Because neurotropic viruses cross the blood-brain barrier to infect brain cells, the same strategy may be used to enter the central nervous system and deliver siRNA to the brain. To enable siRNA binding, this chimeric peptide was synthesized by adding nonamer arginine residues at the carboxy terminus of RVG. This RVG-9R peptide was able to bind and transduce siRNA to neuronal cells in vitro, resulting in efficient gene silencing. After intravenous injection into mice, RVG-9R delivered siRNA to the neuronal cells, resulting in specific gene silencing within the brain. RVG-9R provides a safe and noninvasive approach for the delivery of siRNA and potentially other therapeutic molecules across the blood–brain barrier.

Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20°C
References Kumar, P. et al. Nature 448, 39 (2007).
Molecular Weight 4843.5
Sequence
(One-Letter Code)
YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR
Sequence
(Three-Letter Code)
H - Tyr - Thr - Ile - Trp - Met - Pro - Glu - Asn - Pro - Arg - Pro - Gly - Thr - Pro - Cys - Asp - Ile - Phe - Thr - Asn - Ser - Arg - Gly - Lys - Arg - Ala - Ser - Asn - Gly - Gly - Gly - Gly - Arg - Arg - Arg - Arg - Arg - Arg - Arg - Arg - Arg - OH
     
  < Back