Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  HIV Related Peptides  >>  C34, gp41 HIV Fragment

Product Name C34, gp41 HIV Fragment
Size 1 mg
Catalog # 62101
US$ $297
Purity % Peak Area By HPLC ≥ 95%
Description

This C34 peptide, also known as HR2, belongs to the helical region of gp41 of HIV, C-terminal heptad repeat 2 (HR2) defined as C helix or C peptide. It is known that HIV-1 enters cells by membrane fusion, C34 gp41 peptide is a potent inhibitors of HIV-1 fusion.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20°C
References Bianchi, E. et al. PNAS 102, 12903 (2005), Frey, G. et al. PNAS 103, 13938 (2006), Rosny, E. et al. J. Virol. 78, 2627 (2004).
Molecular Weight 4248.6
Sequence
(One-Letter Code)
WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL
Sequence
(Three-Letter Code)
H - Trp - Met - Glu - Trp - Asp - Arg - Glu - Ile - Asn - Asn - Tyr - Thr - Ser - Leu - Ile - His - Ser - Leu - Ile - Glu - Glu - Ser - Gln - Asn - Gln - Gln - Glu - Lys - Asn - Glu - Gln - Glu - Leu - Leu - OH
     
  < Back