Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Neuropeptides  >>  Galanin Like Peptide (GALP), human

Product Name Galanin Like Peptide (GALP), human
APAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPS
Size 0.5 mg
Catalog # 61845-05
US$ $281
Purity % Peak Area By HPLC ≥ 95%
Description

This 60-amino acid human galanin like peptide (GALP) has homology with rat and porcine GALP. It shows the GALR2-agonistic activity, and induces food intake.

Storage -20C
References Ohtaki, T. et al. J. Biol. Chem. 274, 37041 (1999).
Molecular Weight 6500.4
Sequence
(One-Letter Code)
APAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPS
Sequence
(Three-Letter Code)
H - Ala - Pro - Ala - His - Arg - Gly - Arg - Gly - Gly - Trp - Thr - Leu - Asn - Ser - Ala - Gly - Tyr - Leu - Leu - Gly - Pro - Val - Leu - His - Leu - Pro - Gln - Met - Gly - Asp - Gln - Asp - Gly - Lys - Arg - Glu - Thr - Ala - Leu - Glu - Ile - Leu - Asp - Leu - Trp - Lys - Ala - Ile - Asp - Gly - Leu - Pro - Tyr - Ser - His - Pro - Pro - Gln - Pro - Ser - OH
     
  < Back