Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-40) and Related Peptides  >>  [Cys26]-beta-Amyloid (1-40), S26C beta-Amyloid (1-40), Human

Product Name [Cys26] - beta - Amyloid (1 - 40), S26C beta - Amyloid (1 - 40), Human
DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVV
Size 0.5 mg
Catalog # AS-63671-05
US$ $181
Purity % Peak Area By HPLC ≥ 95%
Storage -20C
Molecular Weight 4345.9
Sequence
(One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVV
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Cys - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH
     
  < Back