Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-40) and Related Peptides  >>  Beta-Amyloid (1-40)-Cys, Human

Product Name Beta - Amyloid (1 - 40) - Cys, Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVC
Size 0.1 mg
Catalog # 62233
US$ $115
Purity % Peak Area By HPLC ≥ 95%
Description

This synthetic peptide corresponds to --Amyloid (1-40) with an additional cysteine at the C-terminus.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
Molecular Weight 4433.0
Sequence
(One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVC
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Cys - OH
     
  < Back