Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-40) and Related Peptides  >>  [Cys7]-beta-Amyloid (1-40), Human

Product Name [Cys7] - beta - Amyloid (1 - 40), Human
DAEFRHCSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Size 0.5 mg
Catalog # 62815-05
US$ $264
Purity % Peak Area By HPLC ≥ 95%
Description

This is amino acids 1-40 fragment of b-amyloid peptide with the Cys7 substitution for Asp7.

Storage -20C
References Ege, C. and K. Lee Biophys. J. 87, 1732 (2004).
Molecular Weight 4317.9
Sequence
(One-Letter Code)
DAEFRHCSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Cys - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH
     
  < Back