Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
	Stay Logged In

Forgot your Customer ID or Password?

New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

[Gly³⁵, Asp³⁷]-beta-Amyloid (1-42)

Product Name	[Gly³⁵, Asp³⁷] - beta - Amyloid (1 - 42)
Size	0.1 mg
Catalog #	62832-01
US$	$137
Purity	% Peak Area By HPLC ≥ 95%
Description	This is amino acids 1 to 42 beta-amyloid peptide with the substitution of Met35 to Gly35, and Gly37 to Asp37.
Storage	-20°C
Molecular Weight	4498.0
Sequence (One-Letter Code)	DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLGVDGVVIA
Sequence (Three-Letter Code)	H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Gly - Val - Asp - Gly - Val - Val - Ile - Ala - OH

Peptides > Signal Transduction Peptides >> [Gly35, Asp37]-beta-Amyloid (1-42)