Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Neuropeptides  >>  Secretoneurin

Product Name Secretoneurin
TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ
Size 1 mg
Catalog # AS-62673
US$ $286
Purity % Peak Area By HPLC ≥ 95%
Description

This peptide is amino acids 154 to 186 fragment of secretogranin II, designated secretoneurin. Secretoneurin is a neuropeptide generated in brain, adrenal medulla and other endocrine tissues by proteolytic processing of secretogranin II. Secretoneurin acts as direct angiogenic cytokine, inhibits endothelial cell (EC) apoptosis, stimulates EC proliferation, and activates the mitogen-activated protein kinase (MAPK) system and the Akt pathway.

Storage -20°C
References Kirchmair R, et al. Neurosci. 53, 359 (1993); Kirchmair R, et al. Circulation 110, 1121 (2004); Fälth, M. et al. Mol. Cell. Proteom. 5, 998 (2006).
Molecular Weight 3652.0
Sequence
(One-Letter Code)
TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ
Sequence
(Three-Letter Code)
H - Thr - Asn - Glu - Ile - Val - Glu - Glu - Gln - Tyr - Thr - Pro - Gln - Ser - Leu - Ala - Thr - Leu - Glu - Ser - Val - Phe - Gln - Glu - Leu - Gly - Lys - Leu - Thr - Gly - Pro - Ser - Asn - Gln - OH
Product Citations Meyer, RC. et al. (2013). GPR37 and GPR37L1 are receptors for the neuroprotective and glioprotective factors prosaptide and prosaposin. Proc Natl Acad Sci 110, 9529. doi: 10.1073/pnas.1219004110.
     
  < Back