This peptide is amino acids 154 to 186 fragment of secretogranin II, designated secretoneurin. Secretoneurin is a neuropeptide generated in brain, adrenal medulla and other endocrine tissues by proteolytic processing of secretogranin II. Secretoneurin acts as direct angiogenic cytokine, inhibits endothelial cell (EC) apoptosis, stimulates EC proliferation, and activates the mitogen-activated protein kinase (MAPK) system and the Akt pathway.
Storage
-20°C
References
Kirchmair R, et al. Neurosci.53, 359 (1993); Kirchmair R, et al. Circulation110, 1121 (2004); Fälth, M. et al. Mol. Cell. Proteom.5, 998 (2006).
Molecular Weight
3652.0
Sequence (One-Letter Code)
TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ
Sequence (Three-Letter Code)
H - Thr - Asn - Glu - Ile - Val - Glu - Glu - Gln - Tyr - Thr - Pro - Gln - Ser - Leu - Ala - Thr - Leu - Glu - Ser - Val - Phe - Gln - Glu - Leu - Gly - Lys - Leu - Thr - Gly - Pro - Ser - Asn - Gln - OH
