Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyte® Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Antimicrobial and Related Peptides  >>  Ubiquitin (1-34)

Product Name Ubiquitin (1 - 34)
Size 1 mg
Catalog # 62587
US$ $297
Purity % Peak Area By HPLC ≥ 95%
Description

This peptide is amino acids 1 to 34 fragment of ubiquitin. The main function of ubiquitin is labeling proteins for proteasomal degradation. Ubiquitin, a 76-residue protein, is shown to have activity against fungal and bacterial pathogens. This N-terminal peptide is stopped at the fungal wall level, whereas C-terminal peptide (residues 65–76) is able to cross the cell wall and the plasma membrane of fungi and to accumulate in fungi. It was shown that these two peptides act synergistically to kill filamentous fungi. This N-terminal peptide could be used with C-terminal-derived peptide as a potent anti-fungal agent.

Storage -20°C
References Kieffer, A. et al. FASEB J. 10.1096/fj.02-0699fje (2003); Ozkaynak, E. et al. Nature 312, 663 (1984).
Molecular Weight 3848.5
Sequence
(One-Letter Code)
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE
Sequence
(Three-Letter Code)
H - Met - Gln - Ile - Phe - Val - Lys - Thr - Leu - Thr - Gly - Lys - Thr - Ile - Thr - Leu - Glu - Val - Glu - Pro - Ser - Asp - Thr - Ile - Glu - Asn - Val - Lys - Ala - Lys - Ile - Gln - Asp - Lys - Glu - OH
     
  < Back